ACSL5 antibody (Middle Region)

Catalog No. ABIN5518721

Product Details anti-ACSL5 Antibody

Target: ACSL5 (Acyl-CoA Synthetase Long-Chain Family Member 5 (ACSL5))

Binding Specificity: AA 337-378, Middle Region

Reactivity: Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACSL5 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Long-chain-fatty-acid--CoA ligase 5(ACSL5) detection. Tested with WB in Human,Mouse,Rat.

Sequence: ADDMKTLKPT LFPAVPRLLN RIYDKVQNEA KTPLKKFLLK LA

Cross-Reactivity (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Characteristics: Rabbit IgG polyclonal antibody for Long-chain-fatty-acid--CoA ligase 5(ACSL5) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: acyl-CoA synthetase long-chain family member 5
Protein Name: Long-chain-fatty-acid--CoA ligase 5

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ACSL5 (337-378aa ADDMKTLKPTLFPAVPRLLNRIYDKVQNEAKTPLKKFLLKLA), different from the related mouse and rat sequences by six amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for ACSL5

Target: ACSL5 (Acyl-CoA Synthetase Long-Chain Family Member 5 (ACSL5))

Alternative Name: ACSL5 (ACSL5 Products)

Synonyms: ACSL5 antibody, acs2 antibody, acs5 antibody, facl5 antibody, ACS2 antibody, ACS5 antibody, FACL5 antibody, 1700030F05Rik antibody, Facl5 antibody, Acs5 antibody, zgc:92083 antibody, acyl-CoA synthetase long chain family member 5 antibody, acyl-CoA synthetase long-chain family member 5 antibody, ACSL5 antibody, acsl5 antibody, Acsl5 antibody

Background: Long-chain-fatty-acid-CoA ligase 5 is an enzyme that in humans is encoded by the ACSL5 gene. The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene.

Synonyms: ACS2 | ACS5 | Acyl CoA synthetase 5 | FACL5 | LACS 5 | Q9ULC5

Gene ID: 51703