Iba1 antibody (C-Term)
-
- Target See all Iba1 (IBA1) Antibodies
- Iba1 (IBA1) (Ionized Calcium-binding Adapter Molecule 1 (IBA1))
-
Binding Specificity
- AA 99-133, C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Iba1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Allograft inflammatory factor 1(AIF1) detection. Tested with WB, IHC-P in Human.
- Sequence
- ETFSYPDFLR MMLGKRSAIL KMILMYEEKA REKEK
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Allograft inflammatory factor 1(AIF1) detection. Tested with WB, IHC-P in Human.
Gene Name: allograft inflammatory factor 1
Protein Name: Allograft inflammatory factor 1 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human Iba1 (99-133aa ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK), different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product IBA1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Alkaloids from piper longum protect dopaminergic neurons against inflammation-mediated damage induced by intranigral injection of lipopolysaccharide." in: BMC complementary and alternative medicine, Vol. 16, Issue 1, pp. 412, (2017) (PubMed).
: "Re-infection of the prion from the scrapie‑infected cell line SMB-S15 in three strains of mice, CD1, C57BL/6 and Balb/c." in: International journal of molecular medicine, Vol. 37, Issue 3, pp. 716-26, (2016) (PubMed).
: "
-
Alkaloids from piper longum protect dopaminergic neurons against inflammation-mediated damage induced by intranigral injection of lipopolysaccharide." in: BMC complementary and alternative medicine, Vol. 16, Issue 1, pp. 412, (2017) (PubMed).
-
- Target
- Iba1 (IBA1) (Ionized Calcium-binding Adapter Molecule 1 (IBA1))
- Alternative Name
- AIF1 (IBA1 Products)
- Synonyms
- AIF-1 antibody, IBA1 antibody, IRT-1 antibody, IRT1 antibody, AI607846 antibody, D17H6S50E antibody, G1 antibody, Iba1 antibody, Bart1 antibody, iba1 antibody, mrf-1 antibody, fa04b11 antibody, wu:fa04b11 antibody, AIF antibody, AIF1 antibody, aif1 antibody, allograft inflammatory factor 1 antibody, AIF1 antibody, Aif1 antibody, aif1 antibody
- Background
-
Allograft inflammatory factor 1 (AIF-1), also known as ionized calcium-binding adapter molecule 1(IBA1), is a protein that in humans is encoded by the AIF1 gene. This gene encodes a protein that binds actin and calcium. And this gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain.
Synonyms: AIF 1 | AIF-1 | AIF1 protein | allograft inflammatory factor 1 | G1 | IBA1 | IBA 1 | Iba1 | P55008 - Gene ID
- 199
- UniProt
- P55008
- Pathways
- Smooth Muscle Cell Migration
-