AKAP2 antibody (C-Term)
-
- Target See all AKAP2 Antibodies
- AKAP2 (A Kinase (PRKA) Anchor Protein 2 (AKAP2))
-
Binding Specificity
- AA 813-852, C-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This AKAP2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for A-kinase anchor protein 2(AKAP2) detection. Tested with WB in Human,Rat.
- Sequence
- ETHKSKRRER MDDSSVLEAT RVNRRKSALA LRWEAGIYAN
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for A-kinase anchor protein 2(AKAP2) detection. Tested with WB in Human,Rat.
Gene Name: A-kinase anchoring protein 2
Protein Name: A-kinase anchor protein 2 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human AKAP2 (813-852aa ETHKSKRRERMDDSSVLEATRVNRRKSALALRWEAGIYAN), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product AKAP2 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- AKAP2 (A Kinase (PRKA) Anchor Protein 2 (AKAP2))
- Alternative Name
- AKAP2 (AKAP2 Products)
- Background
-
A-kinase anchor protein 2 is an enzyme that in humans is encoded by the AKAP2 gene. It is mapped to 9q31.3. The protein encoded by this gene binds to the regulatory subunit of protein kinase A and is found associated with the actin cytoskeleton. The encoded protein mediates signals carried by cAMP and may be involved in creating polarity in certain signaling processes. Three transcript variants encoding different isoforms have been found for this gene.
Synonyms: AKAP 2 | AKAP KL | AKAPKL | KIAA0920 | PRKA 2 | PRKA2 | MISP2 | Q9Y2D5 - Gene ID
- 11217
- UniProt
- Q9Y2D5
-