Superoxide dismutase copper chaperone antibody (C-Term)

Catalog No. ABIN5518744

Product Details anti-Superoxide dismutase copper chaperone Antibody

Target: Superoxide dismutase copper chaperone (CCS) (Copper Chaperone For Superoxide Dismutase (CCS))

Binding Specificity: AA 174-209, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Superoxide dismutase copper chaperone antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Copper chaperone for superoxide dismutase(CCS) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: DADGRAIFRM EDEQLKVWDV IGRSLIIDEG EDDLGR

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Copper chaperone for superoxide dismutase(CCS) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: copper chaperone for superoxide dismutase
Protein Name: Copper chaperone for superoxide dismutase

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CCS (174-209aa DADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGR), different from the related mouse sequence by six amino acids, and from the related rat sequence by seven amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for Superoxide dismutase copper chaperone

Target: Superoxide dismutase copper chaperone (CCS) (Copper Chaperone For Superoxide Dismutase (CCS))

Alternative Name: CCS (CCS Products)

Synonyms: ccs antibody, MGC82563 antibody, CCS antibody, DDBDRAFT_0189222 antibody, DDBDRAFT_0238038 antibody, DDB_0189222 antibody, DDB_0238038 antibody, ATCCS antibody, COPPER/ZINC SUPEROXIDE DISMUTASE COPPER CHAPERONE antibody, F5O11.26 antibody, F5O11_26 antibody, copper chaperone for SOD1 antibody, Ccsd antibody, copper chaperone for superoxide dismutase L homeolog antibody, copper chaperone for superoxide dismutase antibody, copper chaperone for SOD1 antibody, ccs.L antibody, ccs antibody, CCS antibody, LOC552629 antibody, Ccs antibody

Background: Copper chaperone for superoxide dismutase is a metalloprotein that is responsible for the delivery of Cu to superoxide dismutase (SOD1). In humans the protein is encoded by the CCS gene. And this gene is mapped to chromosome 11q13 by fluorescence in situ hybridization. The CCS protein is present in mammals and most eukaryotes including yeast. The structure of CCS is composed of three distinct domains that are necessary for its function. Although CCS is important for many organisms, there are CCS independent pathways for SOD1, and many species lack CCS all together, such as C. elegans.

Synonyms: CCS | SOD 4 | SOD4 | O14618

Gene ID: 9973

UniProt: O14618

Pathways: Transition Metal Ion Homeostasis