Leptin Receptor antibody (C-Term)

Catalog No. ABIN5518771

Product Details anti-Leptin Receptor Antibody

Target: Leptin Receptor (LEPR)

Binding Specificity: AA 793-839, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Leptin Receptor antibody is un-conjugated

Application: ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Leptin receptor(LEPR) detection. Tested with IHC-P, ELISA in Human,Mouse,Rat.

Sequence: KKYYIHDHFI PIEKYQFSLY PIFMEGVGKP KIINSFTQDD IEKHQSD

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Leptin receptor(LEPR) detection. Tested with IHC-P, ELISA in Human,Mouse,Rat.
Gene Name: leptin receptor
Protein Name: Leptin receptor

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Leptin Receptor (793-839aa KKYYIHDHFIPIEKYQFSLYPIFMEGVGKPKIINSFTQDDIEKHQSD), different from the related mouse sequence by nine amino acids, and from the related rat sequence by eight amino acids.

Isotype: IgG

Application Details

Application Notes: IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human

Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-Leptin Receptor antibody (ABIN5518771)

Tu, Kuang, Gong, Shi, Yu, Shi, Wang, Sun: "The Influence of LepR Tyrosine Site Mutations on Mouse Ovary Development and Related Gene Expression Changes." in: PLoS ONE, Vol. 10, Issue 11, pp. e0141800, (2016) (PubMed).

Target Details for Leptin Receptor

Target: Leptin Receptor (LEPR)

Alternative Name: LEPR (LEPR Products)

Synonyms: CD295 antibody, LEP-R antibody, LEPRD antibody, OB-R antibody, OBR antibody, obr antibody, cd295 antibody, ob-rb antibody, Fa antibody, LEPROT antibody, Leprb antibody, Modb1 antibody, OB-RGRP antibody, Obr antibody, db antibody, diabetes antibody, obese-like antibody, obl antibody, ObRb antibody, Ob-R antibody, Ob-RM antibody, lepr antibody, leptin receptor antibody, leptin receptor S homeolog antibody, LEPR antibody, lepr antibody, Lepr antibody, lepr.S antibody

Background: Leptin receptor, also known as LEP-R or OB-R is a protein that in humans is encoded by the LEPR gene. The protein encoded by this gene belongs to the gp130 family of cytokine receptors that are known to stimulate gene transcription via activation of cytosolic STAT proteins. This protein is a receptor for leptin (an adipocyte-specific hormone that regulates body weight), and is involved in the regulation of fat metabolism, as well as in a novel hematopoietic pathway that is required for normal lymphopoiesis. Mutations in this gene have been associated with obesity and pituitary dysfunction. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Synonyms: CD295 | DB | OBR | Fa | Obr | HuB219 | LEP R | LEPR | LEP-R | LEPRD | LEPROT | Leptin receptor | OB R | OB receptor | OB-R | OBRGRP | OB-RGRP | P48357

Gene ID: 3953

UniProt: P48357

Pathways: JAK-STAT Signaling, AMPK Signaling, Feeding Behaviour