PIK3CB antibody (Middle Region)
-
- Target See all PIK3CB Antibodies
- PIK3CB (Phosphoinositide-3-Kinase, Catalytic, beta Polypeptide (PIK3CB))
-
Binding Specificity
- AA 556-598, Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PIK3CB antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform(PIK3CB) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- DLIWTLRQDC REIFPQSLPK LLLSIKWNKL EDVAQLQALL QIW
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform(PIK3CB) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
Protein Name: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human PIK3CB (556-598aa DLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIW), different from the related mouse and rat sequences by one amino acid.
- Isotype
- IgG
- Top Product
- Discover our top product PIK3CB Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
The expression of S100B protein in serum of patients with brain metastases from small-cell lung cancer and its clinical significance." in: Oncology letters, Vol. 14, Issue 6, pp. 7107-7110, (2017) (PubMed).
: "Resveratrol attenuates intermittent hypoxia-induced insulin resistance in rats: involvement of Sirtuin 1 and the phosphatidylinositol-4,5-bisphosphate 3-kinase/AKT pathway." in: Molecular medicine reports, Vol. 11, Issue 1, pp. 151-8, (2014) (PubMed).
: "
-
The expression of S100B protein in serum of patients with brain metastases from small-cell lung cancer and its clinical significance." in: Oncology letters, Vol. 14, Issue 6, pp. 7107-7110, (2017) (PubMed).
-
- Target
- PIK3CB (Phosphoinositide-3-Kinase, Catalytic, beta Polypeptide (PIK3CB))
- Alternative Name
- PIK3CB (PIK3CB Products)
- Synonyms
- P110BETA antibody, PI3K antibody, PI3KBETA antibody, PIK3C1 antibody, fb92a07 antibody, wu:fb92a07 antibody, 1110001J02Rik antibody, AI447572 antibody, p110beta antibody, PI3Kbeta antibody, phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta antibody, phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit beta antibody, PIK3CB antibody, pik3cb antibody, Pik3cb antibody
- Background
-
Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform is an enzyme that in humans is encoded by the PIK3CB gene. This gene encodes an isoform of the catalytic subunit of phosphoinositide 3-kinase (PI3K). These kinases are important in signaling pathways involving receptors on the outer membrane of eukaryotic cells and are named for their catalytic subunit. The encoded protein is the catalytic subunit for PI3Kbeta (PI3KB). PI3KB has been shown to be part of the activation pathway in neutrophils which have bound immune complexes at sites of injury or infection. Alternative splicing results in multiple transcript variants.
Synonyms: p110 BETA | p110Beta | PI3K | PI3K beta | PI3K-beta | PI3Kbeta | PI3KCB | PIK3C1 | Pik3cb | P42338 - Gene ID
- 5291
- UniProt
- P42338
-