OLR1 antibody (Middle Region)
-
- Target See all OLR1 Antibodies
- OLR1 (Oxidized Low Density Lipoprotein (Lectin-Like) Receptor 1 (OLR1))
-
Binding Specificity
- AA 162-197, Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This OLR1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Oxidized low-density lipoprotein receptor 1(OLR1) detection. Tested with WB in Human.
- Sequence
- SFNWEKSQEK CLSLDAKLLK INSTADLDFI QQAISY
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Oxidized low-density lipoprotein receptor 1(OLR1) detection. Tested with WB in Human.
Gene Name: oxidized low density lipoprotein receptor 1
Protein Name: Oxidized low-density lipoprotein receptor 1 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human LOX-1/OLR1 (162-197aa SFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISY), different from the related rat sequence by thirteen amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product OLR1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- OLR1 (Oxidized Low Density Lipoprotein (Lectin-Like) Receptor 1 (OLR1))
- Alternative Name
- OLR1 (OLR1 Products)
- Synonyms
- OLR1 antibody, LOX1 antibody, Olr1 antibody, CLEC8A antibody, LOXIN antibody, SCARE1 antibody, SLOX1 antibody, LOX-1 antibody, SR-EI antibody, Scare1 antibody, Oldlr1 antibody, Oldr1 antibody, PLOX-1 antibody, oxidized low density lipoprotein receptor 1 antibody, oxidized low density lipoprotein (lectin-like) receptor 1 antibody, OLR1 antibody, Olr1 antibody
- Background
-
OLR1(oxidized low density lipoprotein (lectin-like) receptor 1) also called CLEC8A, LOX-1, SCARE1, is a receptor protein which belongs to the C-type lectin superfamily. The OLR1 gene encodes a cell-surface endocytosis receptor for oxidized low density lipoprotein (OxLDL). This gene is mapped on 12p13.2. Incubation of the cells with LDL had no effect on LOX1 expression, but incubation with OxLDL resulted in a dose-dependent increase in LOX1 mRNA and protein expression, however, very high concentrations of OxLDL caused a decrease in OxLDL expression, perhaps indicating toxic effects on endothelial cells. LOX1 was also expressed in macrophages, but not in vascular smooth muscle cells. The findings suggested a role for LOX1 in the pathophysiology of atherosclerotic cardiovascular disease. LOX1 expression was detected in all choroidal neovascular membranes, regardless of structure, whereas there was no evidence of LOX1 within the posterior segments of normal eyes. LOX1 plays an active role in the pathogenesis of choroidal neovascularization, especially in ARMD.
Synonyms: Oxidized low-density lipoprotein receptor 1, Ox-LDL receptor 1, C-type lectin domain family 8 member A, Lectin-like oxidized LDL receptor 1, LOX-1, Lectin-like oxLDL receptor 1, hLOX-1, Lectin-type oxidized LDL receptor 1, Oxidized low-density lipoprotein receptor 1, soluble form, OLR1, CLEC8A, LOX1 - Gene ID
- 4973
- UniProt
- P78380
-