UCP2 antibody (Middle Region)

Catalog No. ABIN5518965

Product Details anti-UCP2 Antibody

Target: UCP2 (Uncoupling Protein 2 (Mitochondrial, Proton Carrier) (UCP2))

Binding Specificity: AA 134-170, Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UCP2 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Mitochondrial uncoupling protein 2(UCP2) detection. Tested with WB in Human,Mouse,Rat.

Sequence: AQPTDVVKVR FQAQARAGGG RRYQSTVNAY KTIAREE

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Mitochondrial uncoupling protein 2(UCP2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: uncoupling protein 2
Protein Name: Mitochondrial uncoupling protein 2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human UCP2 (134-170aa AQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREE), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-UCP2 antibody (ABIN5518965)

Liu, He, Li: "Exhaustive training increases uncoupling protein 2 expression and decreases Bcl-2/Bax ratio in rat skeletal muscle." in: Oxidative medicine and cellular longevity, Vol. 2013, pp. 780719, (2013) (PubMed).

Target Details for UCP2

Target: UCP2 (Uncoupling Protein 2 (Mitochondrial, Proton Carrier) (UCP2))

Alternative Name: UCP2 (UCP2 Products)

Synonyms: UCP2 antibody, DKFZp470P1633 antibody, ucp2 antibody, MGC53319 antibody, MGC75881 antibody, cb74 antibody, ATUCP2 antibody, K19M22.21 antibody, K19M22_21 antibody, uncoupling protein 2 antibody, BMIQ4 antibody, SLC25A8 antibody, UCPH antibody, Slc25a8 antibody, mitochondrial uncoupling protein 2 antibody, uncoupling protein 2 antibody, uncoupling protein 2 (mitochondrial, proton carrier) L homeolog antibody, uncoupling protein 2 (mitochondrial, proton carrier) antibody, uncoupling protein 1 antibody, PTRG_09289 antibody, UCP2 antibody, LOC100282746 antibody, ucp2.L antibody, ucp2 antibody, ucp1 antibody, Ucp2 antibody

Background: Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed in many tissues, with the greatest expression in skeletal muscle. It is thought to play a role in nonshivering thermogenesis, obesity and diabetes. Chromosomal order is 5'-UCP3-UCP2-3'.

Synonyms: Mitochondrial uncoupling protein 2, UCP 2, Solute carrier family 25 member 8, UCPH, UCP2, SLC25A8

Gene ID: 7351

UniProt: P55851

Pathways: Negative Regulation of Hormone Secretion, Carbohydrate Homeostasis, Proton Transport