ASL antibody

Catalog No. ABIN5518971

Product Details anti-ASL Antibody

Target: ASL (Argininosuccinate Lyase (ASL))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ASL antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Adenylosuccinate Lyase detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: YTHLQRAQPI RWSHWILSHA VALTRDSERL LEVRKRIN

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Adenylosuccinate Lyase detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: argininosuccinate lyase
Protein Name: Argininosuccinate lyase

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence of human Adenylosuccinate Lyase (YTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRIN).

Isotype: IgG

Application Details

Application Notes: Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for ASL

Target: ASL (Argininosuccinate Lyase (ASL))

Alternative Name: ASL (ASL Products)

Synonyms: ASAL antibody, 2510006M18Rik antibody, zgc:63532 antibody, BA4879 antibody, PSPTO0125 antibody, Adl antibody, Asl antibody, argininosuccinate lyase antibody, argininosuccinate lyase ArgH antibody, adenylosuccinate lyase antibody, argininosuccinate lyase L homeolog antibody, ASL antibody, Asl antibody, asl antibody, argH2 antibody, argH antibody, arg7 antibody, CNC04420 antibody, STHERM_c13370 antibody, Adsl antibody, asl.L antibody, ARG7 antibody

Background: ASL (argininosuccinatelyase, also known as argininosuccinase) is an enzyme that catalyzes the reversible breakdown of argininosuccinate (ASA) producing the amino acid arginine and dicarboxylic acid fumarate. Located in liver cytosol, ASL is the fourth enzyme of the urea cycle and involved in the biosynthesis of arginine in all species and the production of urea in ureotelic species. Mutations in ASL, resulting low activity of the enzyme, increase levels of urea in the body and result in various side effects. The ASL gene is located on chromosome 7 between the centromere (junction of the long and short arm) and the long (q) arm at position 11.2, from base pair 64,984,963 to base pair 65,002,090.

Synonyms: Argininosuccinate lyase, ASAL, Arginosuccinase, ASL

Gene ID: 435

UniProt: P04424

Pathways: Response to Growth Hormone Stimulus