CD47 antibody

Catalog No. ABIN5518975

Product Details anti-CD47 Antibody

Target: CD47

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CD47 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for CD47 detection. Tested with WB in Human.

Sequence: KSTVPTDFSS AKIEVSQLLK GDASLKMDKS DAVSHT

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for CD47 detection. Tested with WB in Human.
Gene Name: CD47 Molecule
Protein Name: Leukocyte surface antigen CD47

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence of human CD47 (KSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHT).

Isotype: IgG

Application Details

Application Notes: Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for CD47

Target: CD47

Alternative Name: CD47 (CD47 Products)

Synonyms: IAP antibody, MER6 antibody, OA3 antibody, 9130415E20Rik antibody, AA407862 antibody, AI848868 antibody, AW108519 antibody, B430305P08Rik antibody, Itgp antibody, CD47/IAP antibody, alkaline phosphatase, intestinal antibody, CD47 molecule antibody, CD47 antigen (Rh-related antigen, integrin-associated signal transducer) antibody, Cd47 molecule antibody, ALPI antibody, CD47 antibody, Cd47 antibody

Background: CD47, also known as IAP or MER6, is a transmembrane protein that in humans is encoded by the CD47 gene. CD47 gene belongs to the immunoglobulin superfamily. This gene is mapped to 3q13.12. CD47 gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes.

Synonyms: Leukocyte surface antigen CD47, Antigenic surface determinant protein OA3, Integrin-associated protein, IAP, Protein MER6, CD47, CD47, MER6

Gene ID: 961

UniProt: Q08722