IBSP antibody

Catalog No. ABIN5519000

Product Details anti-IBSP Antibody

Target: IBSP (Integrin-Binding Sialoprotein (IBSP))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IBSP antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for IBSP detection. Tested with WB in Human,Mouse,Rat.

Sequence: FSMKNLHRRV KIEDSEENGV FKYRPRYYLY KHAYFYPHLK RFPVQ

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for IBSP detection. Tested with WB in Human,Mouse,Rat.
Gene Name: integrin binding sialoprotein
Protein Name: Bone sialoprotein 2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence of human IBSP (FSMKNLHRRVKIEDSEENGVFKYRPRYYLYKHAYFYPHLKRFPVQ).

Isotype: IgG

Application Details

Application Notes: Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-IBSP antibody (ABIN5519000)

Zhou, Deng, Liu, Li: "Effect of kidney-reinforcing and marrow-beneficial Chinese medicine on bone metabolism-related factors following spinal cord injury in rats." in: Experimental and therapeutic medicine, Vol. 12, Issue 1, pp. 485-491, (2016) (PubMed).

Cheng, Wang, Zhang, Shi: "The osteogenic potential of mesoporous bioglasses/silk and non-mesoporous bioglasses/silk scaffolds in ovariectomized rats: in vitro and in vivo evaluation." in: PLoS ONE, Vol. 8, Issue 11, pp. e81014, (2014) (PubMed).

Target Details for IBSP

Target: IBSP (Integrin-Binding Sialoprotein (IBSP))

Alternative Name: IBSP (IBSP Products)

Synonyms: BNSP antibody, BSP antibody, BSP-II antibody, SP-II antibody, Bsp antibody, BSP II antibody, BSPII antibody, Bsp2 antibody, IBSP antibody, integrin binding sialoprotein antibody, integrin-binding sialoprotein antibody, integrin-binding sialoprotein S homeolog antibody, IBSP antibody, Ibsp antibody, ibsp.S antibody, ibsp antibody

Background: IBSP (integrin-binding sialoprotein) is also known as BSP. The protein encoded by this gene is a major structural protein of the bone matrix. Bone sialoprotein is an acidic glycoprotein of approximately 70 kD that undergoes extensive posttranslational modifications. It constitutes approximately 12 % of the noncollagenous proteins in human bone and is synthesized by skeletal-associated cell types, including hypertrophic chondrocytes, osteoblasts, osteocytes, and osteoclasts. The only extraskeletal site of its synthesis is the trophoblast. This protein binds to calcium and hydroxyapatite via its acidic amino acid clusters, and mediates cell attachment through an RGD sequence that recognizes the vitronectin receptor. The BSP gene is mapped to 4q22.1.

Synonyms: Bone sialoprotein 2, Bone sialoprotein II, BSP II, Cell-binding sialoprotein, Integrin-binding sialoprotein, IBSP, BNSP

Gene ID: 3381

UniProt: P21815