Thymic Stromal Lymphopoietin antibody

Catalog No. ABIN5519071

Product Details anti-Thymic Stromal Lymphopoietin Antibody

Target: Thymic Stromal Lymphopoietin (TSLP)

Reactivity: Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Thymic Stromal Lymphopoietin antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for TSLP detection. Tested with WB in Mouse,Rat.

Sequence: QEMAQEVQNI CLNQTSQILR LWYSFMQSPE

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for TSLP detection. Tested with WB in Mouse,Rat.
Gene Name: thymic stromal lymphopoietin
Protein Name: Thymic stromal lymphopoietin

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence of mouse TSLP (QEMAQEVQNICLNQTSQILRLWYSFMQSPE).

Isotype: IgG

Application Details

Application Notes: Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for Thymic Stromal Lymphopoietin

Target: Thymic Stromal Lymphopoietin (TSLP)

Alternative Name: Tslp (TSLP Products)

Synonyms: TSLP antibody, thymic stromal lymphopoietin antibody, TSLP antibody, Tslp antibody

Background: Thymic stromal lymphopoietin, also called TSLP is a protein belonging to the cytokine family. This gene is mapped to 5q22.1. It encodes a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. It mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c(+) dendritic cells. The protein promotes T helper type 2(TH2) cell responses that are associated with immunity in various inflammatory diseases, including asthma, allergic inflammation and chronic obstructive pulmonary disease. The protein is therefore considered a potential therapeutic target for the treatment of such diseases.

Synonyms: Thymic stromal lymphopoietin, Thymic stroma-derived lymphopoietin, Tslp

Gene ID: 53603