AU RNA Binding Protein/enoyl-CoA Hydratase (AUH) antibody

Details for Product No. ABIN5573207
Target
Reactivity
Human
15
9
9
4
3
3
2
2
1
1
1
Host
Rabbit
12
3
Clonality
Polyclonal
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
15
9
7
1
Options
Purpose Rabbit polyclonal antibody raised against synthetic peptide of human AUH.
Immunogen

immunogen: A synthetic peptide corresponding to C-terminus of human AUH.

Immunogen Sequence: IGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLARE

Cross-Reactivity Human
Target
Alternative Name AUH (AUH Antibody Abstract)
Background Full Gene Name: AU RNA binding protein/enoyl-Coenzyme A hydratase
Gene ID 549
NCBI Accession NP_001689, NM_001698
UniProt Q13825
Application Notes Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 μg/mL)
Western Blot (0.2-1 μg/mL)
The optimal working dilution should be determined by the end user.
Restrictions For Research Use only
Format Liquid
Buffer In PBS (2 % sucrose, 0.09 % sodium azide).
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-AU RNA Binding Protein/enoyl-CoA Hydratase (AUH) antibody (ABIN5573207) Western Blot analysis of HepG2 cell lysate with AUH polyclonal antibody at 0.2-1 ug/...
Image no. 2 for anti-AU RNA Binding Protein/enoyl-CoA Hydratase (AUH) antibody (ABIN5573207) Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kid...