Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

AP1AR antibody (Adaptor-Related Protein Complex 1 Associated Regulatory Protein) Primary Antibody

AP1AR Reactivity: Human IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN5573392
$737.33
Plus shipping costs $45.00
100 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    AP1AR
    Reactivity
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Human
    Host
    • 2
    Rabbit
    Clonality
    • 2
    Polyclonal
    Application
    Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purpose
    Rabbit polyclonal antibody raised against recombinant C4orf16.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: Recombinant protein corresponding to amino acids of human C4orf16.

    Immunogen Sequence: GNCCWTQCFGLLRKEAGRLQRVGGGGGSKYFRTCSRGEHLTIEFENLVESDEGESPGSSHRPLTEEEIVDLRERHYDSIAE

    Isotype
    IgG
  • Application Notes
    Immunohistochemistry (1:200-1:500)
    The optimal working dilution should be determined by the end user.
    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Storage
    4 °C,-20 °C
    Storage Comment
    Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Target
    AP1AR
    Alternative Name
    C4orf16 (AP1AR Antibody Abstract)
    Synonyms
    2C18, C4orf16, GBAR, gamma-BAR, adaptor related protein complex 1 associated regulatory protein, AP1AR
    Background
    Full Gene Name: chromosome 4 open reading frame 16
    Synonyms: 2C18,GBAR,PRO0971
    Gene ID
    55435
    UniProt
    Q63HQ0
You are here:
help Support