Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Carboxylesterase 4A (CES4A) antibody Primary Antibody

CES4A Reactivity: Human IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN5575301
$737.33
Plus shipping costs $45.00
100 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    Carboxylesterase 4A (CES4A)
    Reactivity
    • 25
    • 5
    • 5
    • 2
    • 2
    • 2
    • 1
    Human
    Host
    • 28
    Rabbit
    Clonality
    • 28
    Polyclonal
    Conjugate
    • 9
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Un-conjugated
    Application
    • 23
    • 16
    • 15
    • 2
    • 1
    • 1
    Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purpose
    Rabbit polyclonal antibody raised against recombinant CES4A.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: Recombinant protein corresponding to amino acids of human CES4A.

    Immunogen Sequence: GDPGNVTLFGQSAGAMSISGLMMSPLASGLFHRAISQSGTALFRLFITSNPLKVAKKVAHLAGCNHNSTQILVNCLRALSGTKVMRVSNKMRFLQLNFQRDPEEIIWSMSPVVDGVVIPDDPLVLLTQGKVSSVPYL

    Isotype
    IgG
  • Application Notes
    Immunohistochemistry (1:10-1:20)
    The optimal working dilution should be determined by the end user.
    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Storage
    4 °C,-20 °C
    Storage Comment
    Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Target
    Carboxylesterase 4A (CES4A)
    Alternative Name
    CES4A (CES4A Antibody Abstract)
    Synonyms
    CES6, CES8, Ces8, RGD1307418, CES4A, carboxylesterase 4A, CES4A, Ces4a, LOC454151, LOC102149227
    Background
    Full Gene Name: hypothetical protein FLJ37464
    Gene ID
    283848
    UniProt
    Q5XG92
You are here:
help Support