Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

CLEC4G antibody (C-Type Lectin Domain Family 4, Member G) Primary Antibody

CLEC4G Reactivity: Human IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN5575586
$737.33
Plus shipping costs $45.00
100 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    CLEC4G
    Reactivity
    • 6
    • 1
    Human
    Host
    • 5
    • 1
    Rabbit
    Clonality
    • 5
    • 1
    Polyclonal
    Application
    • 6
    • 2
    Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purpose
    Rabbit polyclonal antibody raised against recombinant CLEC4G.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: Recombinant protein corresponding to amino acids of human CLEC4G.

    Immunogen Sequence: QGFLTRNTRGRGYWLGLRAVRHLGKVQGYQWVDGVSLSFSHWNQGEPNDAWGRENCVMMLHTGLWNDAPCDSEKDGWICEKR

    Isotype
    IgG
  • Application Notes
    Immunohistochemistry (1:50-1:200)
    The optimal working dilution should be determined by the end user.
    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Storage
    4 °C,-20 °C
    Storage Comment
    Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Target
    CLEC4G
    Alternative Name
    CLEC4G (CLEC4G Antibody Abstract)
    Synonyms
    RGD1562320, DTTR431, LP2698, LSECtin, UNQ431, 4930572L20Rik, C-type lectin domain family 4 member G, C-type lectin domain family 4, member G, C-type lectin domain family 4, member g, CLEC4G, Clec4g
    Background
    Full Gene Name: C-type lectin domain family 4, member G
    Synonyms: LP2698,LSECtin,UNQ431
    Gene ID
    339390
    UniProt
    Q6UXB4
You are here:
help Support