CXXC Finger Protein 4 (CXXC4) antibody

Details for Product No. ABIN5576300
Antigen
Reactivity
Human
40
18
7
2
2
2
2
2
1
1
Host
Rabbit
33
7
Clonality
Polyclonal
Conjugate
Un-conjugated
3
3
3
3
3
3
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
32
28
25
15
4
3
1
1
Options
Purpose Rabbit polyclonal antibody raised against recombinant CXXC4.
Immunogen

immunogen: Recombinant protein corresponding to amino acids of human CXXC4.

Immunogen Sequence: GSRTSMHHRNDSQRLGKAGCPPEPSLQMANTNFLSTLSPEHCRPLAGECMNKLKCGAAEAE

Isotype IgG
Cross-Reactivity Human
Antigen
Alternative Name CXXC4 (CXXC4 Antibody Abstract)
Background Full Gene Name: CXXC finger 4
Synonyms: IDAX,MGC149872
Gene ID 80319
UniProt Q9H2H0
Application Notes Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Restrictions For Research Use only
Format Liquid
Buffer In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-CXXC Finger Protein 4 (CXXC4) antibody (ABIN5576300) Immunohistochemical staining of human liver with CXXC4 polyclonal antibody shows str...