DAZ2 antibody (Deleted in Azoospermia 2)

Details for Product anti-DAZ2 Antibody No. ABIN5576430
Antigen
Reactivity
Human
37
7
7
1
1
1
1
1
1
Host
Rabbit
37
Clonality
Polyclonal
Conjugate
This DAZ2 antibody is un-conjugated
4
4
2
2
2
2
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
36
16
5
3
3
1
1
1
Options
Purpose Rabbit polyclonal antibody raised against synthetic peptide of human DAZ2.
Immunogen

immunogen: A synthetic peptide corresponding to N-terminus of human DAZ2.

Immunogen Sequence: MDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQ

Cross-Reactivity Human
Antigen
Alternative Name DAZ2 (DAZ2 Antibody Abstract)
Background Full Gene Name: deleted in azoospermia 2
Synonyms: MGC126442,pDP1678
Gene ID 57055
NCBI Accession NP_001005785, NM_001005785
UniProt Q13117
Application Notes Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 μg/mL)
Western Blot (0.2-1 μg/mL)
The optimal working dilution should be determined by the end user.
Restrictions For Research Use only
Format Liquid
Buffer In PBS (2 % sucrose, 0.09 % sodium azide).
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Deleted in Azoospermia 2 (DAZ2) antibody (ABIN5576430) Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human ski...
Image no. 2 for anti-Deleted in Azoospermia 2 (DAZ2) antibody (ABIN5576430) Western Blot analysis of Daudi cell lysate with DAZ2 polyclonal antibody at 0.2-1 ug...