AMER2 antibody (APC Membrane Recruitment Protein 2)

Details for Product anti-AMER2 Antibody No. ABIN5577734
Antigen
Reactivity
Human
3
2
2
1
1
Host
Rabbit
3
Clonality
Polyclonal
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
3
Options
Purpose Rabbit polyclonal antibody raised against recombinant FAM123A.
Immunogen

immunogen: Recombinant protein corresponding to amino acids of human FAM123A.

Immunogen Sequence: VDDTYLQEFWDMLSQTEEQGPEPQEGAAKVAAALETKVVPETPKDTRCVEAAKDASSVKRRRLNRIPIEPHPKEEPKHPEKEQQE

Isotype IgG
Cross-Reactivity Human
Antigen
Alternative Name FAM123A (AMER2 Antibody Abstract)
Background Full Gene Name: family with sequence similarity 123A
Synonyms: FLJ25477
Gene ID 219287
UniProt Q8N7J2
Application Notes Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Restrictions For Research Use only
Format Liquid
Buffer In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-APC Membrane Recruitment Protein 2 (AMER2) antibody (ABIN5577734) Immunohistochemical staining of human cerebral cortex with FAM123A polyclonal antibod...