Family with Sequence Similarity 162, Member A (FAM162A) antibody

Details for Product No. ABIN5577772
Target
Reactivity
Human
10
8
Host
Rabbit
10
Clonality
Polyclonal
Conjugate
Un-conjugated
1
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
10
7
1
Options
Purpose Rabbit polyclonal antibody raised against recombinant FAM162A.
Immunogen

immunogen: Recombinant protein corresponding to amino acids of human FAM162A.

Immunogen Sequence: SSSLRLTRSSDLKRINGFCTKPQESPGAPSRTYNRVPLHKPTDWQKKILIWSGRFKKEDEIPETVSLEMLDAAKNKMRV

Isotype IgG
Cross-Reactivity Human
Target
Alternative Name FAM162A (FAM162A Antibody Abstract)
Background Full Gene Name: family with sequence similarity 162, member A
Synonyms: C3orf28,E2IG5,HGTD-P
Gene ID 26355
UniProt Q96A26
Pathways Positive Regulation of Endopeptidase Activity, SARS-CoV-2 Protein Interactome
Application Notes Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Restrictions For Research Use only
Format Liquid
Buffer In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-Family with Sequence Similarity 162, Member A (FAM162A) antibody (ABIN5577772) Immunohistochemical staining of human rectum with FAM162A polyclonal antibody strong...
Image no. 2 for anti-Family with Sequence Similarity 162, Member A (FAM162A) antibody (ABIN5577772) Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4...