IVNS1ABP antibody (Influenza Virus NS1A Binding Protein)

Details for Product anti-IVNS1ABP Antibody No. ABIN5581341
Target
Reactivity
Human
10
6
4
4
4
4
3
3
2
2
2
2
1
1
1
Host
Rabbit
10
1
Clonality
Polyclonal
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
11
7
4
3
1
Options
Purpose Rabbit polyclonal antibody raised against recombinant IVNS1ABP.
Immunogen

immunogen: Recombinant protein corresponding to amino acids of human IVNS1ABP.

Immunogen Sequence: QDELIEKPMSPMQYARSGLGTAEMNGKLIAAGGYNREECLRTVECYNPHTDHWSFLAPMRTPRARFQMAVLMGQLYVVGGSNGHSDDLSCGEMYDSNIDDWIPVPELRTNRCNAGVCALNGKLYIVGGSD

Isotype IgG
Cross-Reactivity Human
Target
Alternative Name IVNS1ABP (IVNS1ABP Antibody Abstract)
Background Full Gene Name: influenza virus NS1A binding protein
Synonyms: DKFZp686K06216,FLARA3,FLJ10069,FLJ10411,FLJ10962,FLJ35593,FLJ36593,HSPC068,KIAA0850,ND1,NS-1,NS1-BP,NS1BP
Gene ID 10625
UniProt Q9Y6Y0
Pathways Negative Regulation of intrinsic apoptotic Signaling
Application Notes Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Restrictions For Research Use only
Format Liquid
Buffer In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-Influenza Virus NS1A Binding Protein (IVNS1ABP) antibody (ABIN5581341) Immunohistochemical staining of human rectum with IVNS1ABP polyclonal antibody shows...
Image no. 2 for anti-Influenza Virus NS1A Binding Protein (IVNS1ABP) antibody (ABIN5581341) Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T ly...