Izumo Sperm-Egg Fusion 1 (IZUMO1) antibody

Details for Product No. ABIN5581343
Target
Reactivity
Human
21
2
Host
Rabbit
20
1
Clonality
Polyclonal
Conjugate
Un-conjugated
2
2
2
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
16
15
4
2
1
1
1
Options
Purpose Rabbit polyclonal antibody raised against recombinant IZUMO1.
Immunogen

immunogen: Recombinant protein corresponding to amino acids of human IZUMO1.

Immunogen Sequence: VVLALKSLEKDYLPGHLDAKHHKAMMERVENAVKDFQELSLNEDAYMGVVDEATLQKGSWSLLKDLKRITDSDVKGDLFVKELFWMLHLQKETFATYVARFQKEAYCPNKCGVMLQTLIWCKNCKKEVHACRKSYDCGERNVEVPQM

Isotype IgG
Cross-Reactivity Human
Target
Alternative Name IZUMO1 (IZUMO1 Antibody Abstract)
Background Full Gene Name: izumo sperm-egg fusion 1
Synonyms: FLJ61440,IZUMO,MGC34799
Gene ID 284359
UniProt Q8IYV9
Application Notes Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Restrictions For Research Use only
Format Liquid
Buffer In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-Izumo Sperm-Egg Fusion 1 (IZUMO1) antibody (ABIN5581343) Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T ly...
Image no. 2 for anti-Izumo Sperm-Egg Fusion 1 (IZUMO1) antibody (ABIN5581343) Immunohistochemical staining of human testis with IZUMO1 polyclonal antibody shows s...