PPP1R37 antibody (Protein Phosphatase 1, Regulatory Subunit 37) Primary Antibody
PPP1R37
Reactivity: Human
IHC (p), WB
Host: Rabbit
Polyclonal
camera_alt 2
Catalog No. ABIN5582756
$577.33
Plus shipping costs $45.00
100 μL
local_shipping
Shipping to:
United States
Delivery in 11 to 12 Business Days
-
- Target
- Reactivity
- Human
- Host
- Rabbit
- Clonality
- Polyclonal
- Conjugate
- This PPP1R37 antibody is un-conjugated
- Application
- Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
- Purpose
- Rabbit polyclonal antibody raised against recombinant LRRC68.
- Cross-Reactivity
- Human
- Immunogen
immunogen: Recombinant protein corresponding to amino acids of human LRRC68.
Immunogen Sequence: TVDEVIGAYKQACQKLNCRQIPKLLRQLQEFTDLGHRLDCLDLKGEKLDYKTCEALEEVFKRLQFKVVDLEQTNLDEDGASALFDMIEYYESATHL
- Isotype
- IgG
-
-
- Application Notes
- Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user. - Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- In PBS, pH 7.2, (40 % glycerol, 0.02 % sodium azide)
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
- Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
-
- Target
- Alternative Name
- LRRC68 (PPP1R37 Antibody Abstract)
- Background
- Full Gene Name: leucine rich repeat containing 68
Synonyms: KIAA1986 - Gene ID
- 284352
You are here: