Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

PCNXL2 antibody (Pecanex-Like 2 (Drosophila)) Primary Antibody

PCNXL2 Reactivity: Human IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN5585334
$737.33
Plus shipping costs $45.00
100 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    PCNXL2
    Reactivity
    • 3
    • 1
    • 1
    Human
    Host
    • 3
    Rabbit
    Clonality
    • 3
    Polyclonal
    Application
    • 3
    • 2
    Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purpose
    Rabbit polyclonal antibody raised against recombinant PCNXL2.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: Recombinant protein corresponding to amino acids of human PCNXL2.

    Immunogen Sequence: LPLHQEVDSSDSEVAVTLIDTSQPGDPLSLHEPIKIVITMSSTPNSMTDLESSLHLRVVGTEKTSVKSDAEPTNPGAAGSPNAEQISIPVITLDLPEGGGGGVPCPE

    Isotype
    IgG
  • Application Notes
    Immunohistochemistry (1:200-1:500)
    The optimal working dilution should be determined by the end user.
    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Storage
    4 °C,-20 °C
    Storage Comment
    Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Target
    PCNXL2
    Alternative Name
    PCNXL2 (PCNXL2 Antibody Abstract)
    Synonyms
    A830048P05, AU067631, E330039K12Rik, mKIAA0435, pecanex homolog 2, PCNX2, Pcnx2
    Background
    Full Gene Name: pecanex-like 2 (Drosophila)
    Synonyms: FLJ11383,KIAA0435
    Gene ID
    80003
    UniProt
    A6NKB5
You are here:
help Support