Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

RASA2 antibody (RAS P21 Protein Activator 2) Primary Antibody

RASA2 Reactivity: Human IF, IHC (p), WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN5586775
$737.33
Plus shipping costs $45.00
100 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    RASA2
    Reactivity
    Human
    • 19
    • 16
    • 16
    Host
    Rabbit
    • 19
    Clonality
    Polyclonal
    Conjugate
    This RASA2 antibody is un-conjugated
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Application
    Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
    • 13
    • 7
    • 3
    • 2
    • 1
    • 1
    Purpose
    Rabbit polyclonal antibody raised against recombinant RASA2.
    Cross-Reactivity
    Human, Mouse (Murine), Rat (Rattus)
    Immunogen

    immunogen: Recombinant protein corresponding to amino acids of human RASA2.

    Immunogen Sequence: PDDYSNFVIEDSVTTFKTIQQIKSIIEKLDEPHEKYRKKRSSSAKYGSKENPIVGKAS

    Isotype
    IgG
  • Application Notes
    Immunohistochemistry (1:50-1:200)
    Western Blot (1:250-1:500)
    Immunofluorescence (1-4 μg/mL)
    The optimal working dilution should be determined by the end user.
    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Storage
    4 °C,-20 °C
    Storage Comment
    Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Target
    RASA2
    Alternative Name
    RASA2 (RASA2 Antibody Abstract)
    Synonyms
    GAP1M, 5430433H21Rik, AA517451, AU023900, GAP1m, RAS p21 protein activator 2, RASA2, Rasa2
    Background
    Full Gene Name: RAS p21 protein activator 2
    Synonyms: GAP1M
    Gene ID
    5922
    UniProt
    Q15283
You are here:
help Support