Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

RPL9 antibody (Ribosomal Protein L9) Primary Antibody

RPL9 Reactivity: Human IF, IHC (p), WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN5587164
$577.33
Plus shipping costs $45.00
100 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    RPL9
    Reactivity
    Human
    • 43
    • 35
    • 18
    • 7
    • 6
    • 4
    • 4
    • 4
    • 3
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    Host
    Rabbit
    Clonality
    Polyclonal
    Conjugate
    This RPL9 antibody is un-conjugated
    • 29
    • 5
    • 4
    • 4
    • 4
    • 4
    • 4
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Application
    Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
    • 55
    • 38
    • 8
    • 6
    • 2
    • 1
    • 1
    • 1
    • 1
    Purpose
    Rabbit polyclonal antibody raised against recombinant human RPL9.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: Recombinant protein corresponding to human RPL9.

    Immunogen Sequence: SVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE

    Isotype
    IgG
  • Application Notes
    Immunohistochemistry
    Immunofluorescence (1-4 μg/mL)
    Western Blot
    The optimal working dilution should be determined by the end user.
    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Storage
    4 °C,-20 °C
    Storage Comment
    Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Target
    RPL9
    Alternative Name
    RPL9 (RPL9 Antibody Abstract)
    Synonyms
    CG6141, Dmel\\CG6141, L9, M(2)32D, Rp L9, Rpl9, anon-EST:fe3A6, anon-WO0153538.25, anon-WO0153538.26, anon-WO0153538.27, rpL9, ab02c03, fa93a01, mg:ab02c03, wu:fa93a01, zgc:103730, NPC-A-16, Ribosomal protein L9, 60S ribosomal protein L9, ribosomal protein L9, ribosomal protein L9 L homeolog, RpL9, rpl-9, rpl9, rpl9.L, RPL9, Rpl9
    Background
    Full Gene Name: ribosomal protein L9
    Synonyms: DKFZp313J1510,FLJ27456,MGC15545,NPC-A-16
    Gene ID
    6133
You are here:
help Support