SHQ1 antibody (SHQ1 Homolog (S. Cerevisiae))

Details for Product anti-SHQ1 Antibody No. ABIN5587898
Antigen
Reactivity
Human
20
14
4
2
2
2
2
2
2
1
1
Host
Rabbit
32
Clonality
Polyclonal
Conjugate
This SHQ1 antibody is un-conjugated
3
2
2
2
2
2
Application
Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
32
20
18
3
3
3
2
1
Options
Purpose Rabbit polyclonal antibody raised against recombinant SHQ1.
Immunogen

immunogen: Recombinant protein corresponding to amino acids of human SHQ1.

Immunogen Sequence: ELKDSPSETVSSLQGPFLEESSAFLIVDGGVRRNTAIQESDASQGKPLASSWPLGVSGPLIEELGEQLKTTVQVSEPKGTTAVNRSNIQERDGCQTPNN

Isotype IgG
Cross-Reactivity Human
Antigen
Alternative Name SHQ1 (SHQ1 Antibody Abstract)
Background Full Gene Name: SHQ1 homolog (S. cerevisiae)
Synonyms: DKFZp686H07226,FLJ10539
Gene ID 55164
Pathways Ribonucleoprotein Complex Subunit Organization
Application Notes Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 μg/mL)
The optimal working dilution should be determined by the end user.
Restrictions For Research Use only
Format Liquid
Buffer In PBS, pH 7.2, (40 % glycerol, 0.02 % sodium azide)
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-SHQ1 Homolog (S. Cerevisiae) (SHQ1) antibody (ABIN5587898) Immunofluorescent staining of human cell line A-431 with SHQ1 polyclonal antibody at...
Image no. 2 for anti-SHQ1 Homolog (S. Cerevisiae) (SHQ1) antibody (ABIN5587898) Immunohistochemical staining of human vagina with SHQ1 polyclonal antibody shows str...