SIGLEC14 antibody (Sialic Acid Binding Ig-Like Lectin 14)

Details for Product anti-SIGLEC14 Antibody No. ABIN5587912
Antigen
Reactivity
Human
46
2
2
Host
Rabbit
45
1
Clonality
Polyclonal
Conjugate
This SIGLEC14 antibody is un-conjugated
6
2
2
2
2
2
2
2
2
2
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
29
21
10
9
1
1
1
1
1
1
1
Options
Purpose Rabbit polyclonal antibody raised against partial recombinant human SIGLEC14.
Immunogen

immunogen: Recombinant protein corresponding to human SIGLEC14.

Immunogen Sequence: CQVKRQGAQVTTERTVQLNVSYAPQNLAISIFFRNGTGTALRILSNGMSVPIQEGQSLFLACTVDSNPPASLSWFREGKALNPSQTSMSGTLELPNIGAREGGEFTCRVQHPLGSQHLSF

Isotype IgG
Cross-Reactivity Human
Antigen
Alternative Name SIGLEC14 (SIGLEC14 Antibody Abstract)
Background Full Gene Name: sialic acid binding Ig-like lectin 14
Gene ID 100049587
UniProt Q08ET2
Application Notes Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Restrictions For Research Use only
Format Liquid
Buffer In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide).
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Sialic Acid Binding Ig-Like Lectin 14 (SIGLEC14) antibody (ABIN5587912) Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liv...