Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

SLC38A10 antibody (Solute Carrier Family 38, Member 10) Primary Antibody

SLC38A10 Reactivity: Human IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN5588193
$737.33
Plus shipping costs $45.00
100 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    SLC38A10
    Reactivity
    • 3
    • 1
    • 1
    • 1
    • 1
    Human
    Host
    • 3
    Rabbit
    Clonality
    • 3
    Polyclonal
    Application
    • 3
    • 1
    Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purpose
    Rabbit polyclonal antibody raised against recombinant SLC38A10.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: Recombinant protein corresponding to amino acids of human SLC38A10.

    Immunogen Sequence: PVPHDKVVVDEGQDREVPEENKPPSRHAGGKAPGVQGQMAPPLPDSEREKQEPEQGEVGKRPGQAQALEEAGDLPEDPQKVPEADGQPA

    Isotype
    IgG
  • Application Notes
    Immunohistochemistry (1:50-1:200)
    The optimal working dilution should be determined by the end user.
    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Storage
    4 °C,-20 °C
    Storage Comment
    Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Target
    SLC38A10
    Alternative Name
    SLC38A10 (SLC38A10 Antibody Abstract)
    Synonyms
    1810073N04Rik, solute carrier family 38 member 10, solute carrier family 38, member 10, solute carrier family 38 member 10 S homeolog, SLC38A10, Slc38a10, slc38a10.S
    Background
    Full Gene Name: solute carrier family 38, member 10
    Synonyms: FLJ35718,MGC15523,PP1744
    Gene ID
    124565
    UniProt
    Q9HBR0
You are here:
help Support