USP4 antibody (Ubiquitin Specific Peptidase 4) Primary Antibody
USP4
Reactivity: Human
IF, IHC (p), WB
Host: Rabbit
Polyclonal
camera_alt 3
Catalog No. ABIN5590631
$577.33
Plus shipping costs $45.00
100 μL
local_shipping
Shipping to:
United States
Delivery in 11 to 12 Business Days
-
- Target
- Reactivity
- Human
- Host
- Rabbit
- Clonality
- Polyclonal
- Conjugate
- This USP4 antibody is un-conjugated
- Application
- Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
- Purpose
- Rabbit polyclonal antibody raised against recombinant human USP4.
- Cross-Reactivity
- Human, Mouse (Murine), Rat (Rattus)
- Immunogen
immunogen: Recombinant protein corresponding to human USP4.
Immunogen Sequence: NMVVADVYNHRFHKIFQMDEGLNHIMPRDDIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPL
- Isotype
- IgG
-
-
- Application Notes
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user. - Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
- Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
-
- Target
- Alternative Name
- USP4 (USP4 Antibody Abstract)
- Synonyms
- UNP, Unph, F730026I20Rik, Unp, mKIAA4155, ubiquitin specific peptidase 4, ubiquitin specific peptidase 4 (proto-oncogene), USP4, Usp4
- Background
- Full Gene Name: ubiquitin specific peptidase 4 (proto-oncogene)
Synonyms: MGC149848,MGC149849,UNP,Unph - Gene ID
- 7375
- UniProt
- Q13107
You are here: