RUNX1T1 antibody (Runt-Related Transcription Factor 1, Translocated To, 1 (Cyclin D-Related)) (AA 416-525)

Details for Product anti-RUNX1T1 Antibody No. ABIN560189
Target
Binding Specificity
AA 416-525
6
6
3
2
2
1
1
1
1
1
Reactivity
Human
41
20
10
7
6
5
4
4
4
3
3
3
2
1
Host
Mouse
37
4
Clonality
Polyclonal
Conjugate
This RUNX1T1 antibody is un-conjugated
2
1
1
1
1
1
1
1
1
Application
ELISA, Western Blotting (WB)
25
19
7
4
3
2
1
1
1
1
Options
Purpose Mouse polyclonal antibody raised against a partial recombinant RUNX1T1.
Immunogen

immunogen: RUNX1T1 (NP_004340, 416 a.a. ~ 525 a.a) partial recombinant protein with GST tag.

Immunogen Sequence: EEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICG

Cross-Reactivity Human
Target
Alternative Name RUNX1T1 (RUNX1T1 Antibody Abstract)
Background Full Gene Name: runt-related transcription factor 1, translocated to, 1 (cyclin D-related)
Synonyms: AML1T1,CBFA2T1,CDR,ETO,MGC2796,MTG8,MTG8b,ZMYND2
Gene ID 862
NCBI Accession NP_004340, NM_004349
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Format Liquid
Buffer 50 % glycerol
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-Runt-Related Transcription Factor 1, Translocated To, 1 (Cyclin D-Related) (RUNX1T1) (AA 416-525) antibody (ABIN560189) Western Blot detection against Immunogen (38.21 KDa) .
Product cited in: Chu, Liu, Nix, Wu, Ralston, Yates, Meyer: "Sperm chromatin proteomics identifies evolutionarily conserved fertility factors." in: Nature, Vol. 443, Issue 7107, pp. 101-5, 2006 (PubMed).

Abdelhaleem: "RNA helicases: regulators of differentiation." in: Clinical biochemistry, Vol. 38, Issue 6, pp. 499-503, 2005 (PubMed).

Hoet, Cohen, Kent, Rookey, Schoonbroodt, Hogan, Rem, Frans, Daukandt, Pieters, van Hegelsom, Neer, Nastri, Rondon, Leeds, Hufton, Huang, Kashin, Devlin, Kuang, Steukers, Viswanathan, Nixon, Sexton et al.: "Generation of high-affinity human antibodies by combining donor-derived and synthetic complementarity-determining-region diversity. ..." in: Nature biotechnology, Vol. 23, Issue 3, pp. 344-8, 2005 (PubMed).

Zeeman, Stoop, Boter, Gillis, Castrillon, Oosterhuis, Looijenga: "VASA is a specific marker for both normal and malignant human germ cells." in: Laboratory investigation; a journal of technical methods and pathology, Vol. 82, Issue 2, pp. 159-66, 2002 (PubMed).