Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

HIST1H3D antibody (Histone Cluster 1, H3d) (AA 1-136) Primary Antibody

HIST1H3D Reactivity: Human ELISA, WB Host: Mouse Polyclonal unconjugated
Catalog No. ABIN563598
$465.71
Plus shipping costs $45.00
50 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    HIST1H3D
    Binding Specificity
    • 1
    • 1
    • 1
    • 1
    AA 1-136
    Reactivity
    • 6
    • 2
    Human
    Host
    • 3
    • 3
    Mouse
    Clonality
    • 3
    • 3
    Polyclonal
    Application
    • 6
    • 5
    • 4
    • 4
    ELISA, Western Blotting (WB)
    Purpose
    Mouse polyclonal antibody raised against a full-length recombinant HIST1H3D.
    Cross-Reactivity
    Human, Mouse (Murine)
    Immunogen

    immunogen: HIST1H3D (AAH31333, 1 a.a. ~ 136 a.a) full-length recombinant protein with GST tag.

    Immunogen Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    50 % glycerol
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    HIST1H3D
    Alternative Name
    HIST1H3D (HIST1H3D Antibody Abstract)
    Synonyms
    H3/b, H3FB, H3-b, HIST1H3J, histone cluster 1 H3 family member d, histone cluster 1, H3d, HIST1H3D, Hist1h3d
    Background
    Full Gene Name: histone cluster 1, H3d
    Synonyms: H3/b,H3FB
    Gene ID
    8351
You are here:
help Support