AMHR2 antibody

Catalog No. ABIN5647325

Product Details anti-AMHR2 Antibody

Target: AMHR2 (Anti-Mullerian Hormone Receptor, Type II (AMHR2))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AMHR2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogen: Amino acids QRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWE were used as the immunogen for the AMHR2 antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: Prior to reconstitution, store at 4°C. After reconstitution, the AMHR2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for AMHR2

Target: AMHR2 (Anti-Mullerian Hormone Receptor, Type II (AMHR2))

Alternative Name: AMHR2 (AMHR2 Products)

Synonyms: AMHR antibody, MISR2 antibody, MISRII antibody, MRII antibody, Misiir antibody, Misrii antibody, Mrii antibody, anti-Mullerian hormone receptor type 2 antibody, anti-Mullerian hormone type 2 receptor antibody, AMHR2 antibody, Amhr2 antibody

Target Type: Antibody

Background: AMHR2 is the receptor for the anti-Mullerian hormone (AMH) which, in addition to testosterone, results in male sex differentiation. AMH and testosterone are produced in the testes by different cells and have different effects. Testosterone promotes the development of male genitalia while the binding of AMH to the encoded receptor prevents the development of the mullerian ducts into uterus and Fallopian tubes. Mutations in this gene are associated with persistent Mullerian duct syndrome type II. Alternatively spliced transcript variants encoding different isoforms have been identified.

UniProt: Q16671