HTRA1 antibody

Catalog No. ABIN5647348

Product Details anti-HTRA1 Antibody

Target: HTRA1 (HtrA Serine Peptidase 1 (HTRA1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HTRA1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids QLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIAD were used as the immunogen for the HTRA1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the HTRA1 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the HTRA1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for HTRA1

Target: HTRA1 (HtrA Serine Peptidase 1 (HTRA1))

Alternative Name: HTRA1 (HTRA1 Products)

Synonyms: htra1 antibody, zgc:92029 antibody, zgc:172061 antibody, l56 antibody, htra antibody, Xhtra1 antibody, prss11 antibody, MGC145723 antibody, ARMD7 antibody, CARASIL antibody, HtrA antibody, L56 antibody, ORF480 antibody, PRSS11 antibody, AI429470 antibody, HTRA antibody, Prss11 antibody, RSPP11 antibody, HTRA1 antibody, HtrA serine peptidase 1a antibody, HtrA serine peptidase 1 antibody, HtrA serine peptidase 1b antibody, Serine protease HTRA1 antibody, HtrA serine peptidase 1 S homeolog antibody, htra1a antibody, HTRA1 antibody, htra1b antibody, htra1 antibody, Htra1 antibody, htra1.S antibody

Background: Serine protease HTRA1 is an enzyme that in humans is encoded by the HTRA1 gene. This gene encodes a member of the trypsin family of serine proteases. This protein is a secreted enzyme that is proposed to regulate the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. It has also been suggested to be a regulator of cell growth. Variations in the promoter region of this gene are the cause of susceptibility to age-related macular degeneration type 7.

UniProt: Q92743

Pathways: Growth Factor Binding