ABCA4 antibody (AA 1890-1927)

Catalog No. ABIN5647438

Product Details anti-ABCA4 Antibody

Target: ABCA4 (ATP-Binding Cassette, Sub-Family A (ABC1), Member 4 (ABCA4))

Binding Specificity: AA 1890-1927

Reactivity: Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABCA4 antibody is un-conjugated

Application: Western Blotting (WB)

Cross-Reactivity (Details): Expected species reactivity: Human

Purification: Antigen affinity purified

Immunogen: Amino acids 1890-1927 (FLLTLLVQRHFFLSQWIAEPTKEPIVDEDDDVAEERQR) from the human protein were used as the immunogen for the ABCA4 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the ABCA4 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the ABCA4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for ABCA4

Target: ABCA4 (ATP-Binding Cassette, Sub-Family A (ABC1), Member 4 (ABCA4))

Alternative Name: ABCA4 (ABCA4 Products)

Synonyms: ABC10 antibody, ABCR antibody, ARMD2 antibody, CORD3 antibody, FFM antibody, RMP antibody, RP19 antibody, STGD antibody, STGD1 antibody, AW050280 antibody, Abc10 antibody, Abcr antibody, D430003I15Rik antibody, RmP antibody, abcr antibody, ffm antibody, rmp antibody, rp19 antibody, stgd antibody, abc10 antibody, armd2 antibody, cord3 antibody, stgd1 antibody, zgc:91823 antibody, ATP binding cassette subfamily A member 4 antibody, ATP-binding cassette, sub-family A (ABC1), member 4 antibody, ATP binding cassette subfamily A member 4 L homeolog antibody, ATP-binding cassette, sub-family A (ABC1), member 4a antibody, ABCA4 antibody, Abca4 antibody, abca4 antibody, abca4.L antibody, abca4a antibody

Background: ABCA4 (ATP-Binding Cassette, Subfamily A, Member 4), also known as ABCR, is a protein which in humans is encoded by the ABCA4 gene. ABCA4 is a member of the ATP-binding cassette transporter gene sub-family A (ABC1) found exclusively in multicellular eukaryotes. Using a whole genome radiation hybrid panel, this gene is mapped to 1p21-p13. And this gene is expressed exclusively in retina photoreceptor cells, indicating the gene product mediates transport of an essental molecule across the photoreceptor cell membrane. Additionally, it is showed by immunofluorescence microscopy and Western blot analysis that ABCR is present in foveal and peripheral cone, as well as rod, photoreceptors. The results suggested that the loss in central vision experienced by patients with Stargardt macular dystrophy arises directly from ABCR-mediated foveal cone degeneration.

UniProt: P78363