ANGPTL2 antibody (AA 275-312)

Catalog No. ABIN5647463

Product Details anti-ANGPTL2 Antibody

Target: ANGPTL2 (Angiopoietin-Like 2 (ANGPTL2))

Binding Specificity: AA 275-312

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ANGPTL2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids 275-312 (WRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHD) from the human protein were used as the immunogen for the ANGPTL2 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the ANGPTL2 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the ANGPTL2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for ANGPTL2

Target: ANGPTL2 (Angiopoietin-Like 2 (ANGPTL2))

Alternative Name: ANGPTL2 (ANGPTL2 Products)

Synonyms: ARP2 antibody, HARP antibody, AI593246 antibody, AW260363 antibody, Arp2 antibody, ANGPTL2 antibody, angptl2 antibody, wu:fc41g02 antibody, arp2 antibody, fbnl antibody, harp antibody, angptl2a antibody, angiopoietin like 2 antibody, angiopoietin-like 2 antibody, angiopoietin-like 2b antibody, angiopoietin like 2 L homeolog antibody, ANGPTL2 antibody, Angptl2 antibody, angptl2b antibody, angptl2 antibody, angptl2.L antibody

Background: Angiopoietin-related protein 2, also known as Angiopoietin-like protein 2, is a protein that in humans is encoded by the ANGPTL2 gene. Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. ANGPTL2 protein is a secreted glycoprotein with homology to the angiopoietins and may exert a function on endothelial cells through autocrine or paracrine action.

UniProt: Q9UKU9