CDC20 antibody
-
- Target See all CDC20 Antibodies
- CDC20 (Cell Division Cycle 20 Homolog (S. Cerevisiae) (CDC20))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CDC20 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purification
- Antigen affinity purified
- Immunogen
- Amino acids QTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKAT were used as the immunogen for the Cdc20 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product CDC20 Primary Antibody
-
anti-Cell Division Cycle 20 Homolog (S. Cerevisiae) (CDC20) (AA 1-270) antibody
CDC20 Reactivity: Human WB, IF, IHC, IP Host: Rabbit Polyclonal unconjugated
anti-Cell Division Cycle 20 Homolog (S. Cerevisiae) (CDC20) antibodyCDC20 Reactivity: Human, Mouse, Rat WB, IHC Host: Rabbit Polyclonal unconjugated
anti-Cell Division Cycle 20 Homolog (S. Cerevisiae) (CDC20) (AA 1-270) antibodyCDC20 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
anti-Cell Division Cycle 20 Homolog (S. Cerevisiae) (CDC20) (AA 57-84) antibodyCDC20 Reactivity: Human WB, FACS, ELISA Host: Rabbit Polyclonal unconjugated
anti-Cell Division Cycle 20 Homolog (S. Cerevisiae) (CDC20) (AA 57-84), (N-Term) antibodyCDC20 Reactivity: Human WB, FACS Host: Rabbit Polyclonal RB23122 unconjugated
anti-Cell Division Cycle 20 Homolog (S. Cerevisiae) (CDC20) antibodyCDC20 Reactivity: Human FACS, IF, IHC, StM Host: Mouse Monoclonal AR12 unconjugated
anti-Cell Division Cycle 20 Homolog (S. Cerevisiae) (CDC20) (N-Term) antibodyCDC20 Reactivity: Human, Mouse, Rat WB, IF, ELISA, ICC Host: Rabbit Polyclonal unconjugated
anti-Cell Division Cycle 20 Homolog (S. Cerevisiae) (CDC20) (AA 1-499) antibodyCDC20 Reactivity: Human WB, PLA Host: Rabbit Polyclonal unconjugated
anti-Cell Division Cycle 20 Homolog (S. Cerevisiae) (CDC20) (N-Term) antibodyCDC20 Reactivity: Human, Mouse, Rat, Pig, Horse, Guinea Pig, Monkey, Cow, Xenopus laevis, Bat, Hamster WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Cell Division Cycle 20 Homolog (S. Cerevisiae) (CDC20) antibodyCDC20 Reactivity: Human, Mouse, Rat WB, ELISA Host: Rabbit Polyclonal unconjugated
-
- Application Notes
- Optimal dilution of the Cdc20 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the Cdc20 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- CDC20 (Cell Division Cycle 20 Homolog (S. Cerevisiae) (CDC20))
- Alternative Name
- Cdc20 (CDC20 Products)
- Synonyms
- X-FZY antibody, ba276h19.3 antibody, cdc20a antibody, fizzy1 antibody, p55cdc antibody, CDC20A antibody, bA276H19.3 antibody, p55CDC antibody, 2310042N09Rik antibody, C87100 antibody, cell division cycle 20 antibody, cell division cycle 20 L homeolog antibody, cell division cycle 20 homolog (S. cerevisiae) antibody, cdc20 antibody, CDC20 antibody, cdc20.L antibody, Cdc20 antibody
- Background
- The cell-division cycle protein 20, also known as p55CDC, is an essential regulator of cell division that is encoded by the CDC20 gene in humans. The chromosomal assignment of human CDC20 is 1p34.2. CDC20 is a component of the mammalian cell cycle mechanism. CDC20 appears to act as a regulatory protein interacting with many other proteins at multiple points in the cell cycle. This gene's most important function is to activate the anaphase promoting complex (APC), a large 11-13 subunit complex that initiates chromatid separation and entrance into anaphase.
- UniProt
- Q12834
-
