HMGB2 antibody
-
- Target See all HMGB2 Antibodies
- HMGB2 (High Mobility Group Box 2 (HMGB2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HMGB2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purification
- Antigen affinity purified
- Immunogen
- Amino acids KSDKARYDREMKNYVPPKGDKKGKKKDPNAPKR were used as the immunogen for the HMGB2 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product HMGB2 Primary Antibody
-
-
- Application Notes
- Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- Prior to reconstitution, store at 4°C. After reconstitution, the HMGB2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- HMGB2 (High Mobility Group Box 2 (HMGB2))
- Alternative Name
- HMGB2 (HMGB2 Products)
- Synonyms
- HMG2 antibody, C80539 antibody, HMG-2 antibody, Hmg2 antibody, HIGH MOBILITY GROUP BETA 1 antibody, HMG BETA 1 antibody, NFD02 antibody, NFD2 antibody, NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP D 02 antibody, NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP D 2 antibody, high mobility group B2 antibody, hmgb2 antibody, hmgb2l antibody, im:6909096 antibody, wu:fa20b02 antibody, zgc:101854 antibody, wu:fb22b10 antibody, wu:fc95d12 antibody, zgc:123215 antibody, high mobility group box 2 antibody, high mobility group box 2 S homeolog antibody, high mobility group B2 antibody, high mobility group box 2b antibody, high mobility group box 2a antibody, HMGB2 antibody, Hmgb2 antibody, hmgb2.S antibody, hmgb2b antibody, hmgb2a antibody
- Background
- High-mobility group protein B2, also known as high-mobility group protein 2 (HMG-2), is a protein that in humans is encoded by the HMGB2 gene. This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination.
- UniProt
- P26583
- Pathways
- Cellular Response to Molecule of Bacterial Origin
-