KDM5B antibody (AA 641-685)

Catalog No. ABIN5647866

Product Details anti-KDM5B Antibody

Target: KDM5B (Lysine (K)-Specific Demethylase 5B (KDM5B))

Binding Specificity: AA 641-685

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KDM5B antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogen: Amino acids 641-685 (DVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELL) from the human protein were used as the immunogen for the KDM5B antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the KDM5B antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for KDM5B

Target: KDM5B (Lysine (K)-Specific Demethylase 5B (KDM5B))

Alternative Name: KDM5B / Jarid1B (KDM5B Products)

Synonyms: jarid1b antibody, jarid1ba antibody, id:ibd5050 antibody, wu:fd15c05 antibody, cb264 antibody, jarid1bb antibody, plu1 antibody, wu:fc44h11 antibody, zgc:85741 antibody, JARID1B antibody, CT31 antibody, PLU-1 antibody, PLU1 antibody, PUT1 antibody, RBBP2H1A antibody, 2010009J12Rik antibody, 2210016I17Rik antibody, AW556288 antibody, D1Ertd202e antibody, Jarid1b antibody, Plu1 antibody, Rb-Bp2 antibody, mKIAA4034 antibody, RGD1565602 antibody, lysine (K)-specific demethylase 5Ba antibody, lysine (K)-specific demethylase 5Bb antibody, lysine demethylase 5B antibody, lysine (K)-specific demethylase 5B antibody, kdm5ba antibody, kdm5bb antibody, KDM5B antibody, Kdm5b antibody

Background: Lysine-specific demethylase 5B, also known as histone demethylase JARID1B, is a demethylase enzyme that in humans is encoded by the KDM5B gene. This gene encodes a lysine-specific histone demethylase that belongs to the jumonji/ARID domain-containing family of histone demethylases. The encoded protein is capable of demethylating tri-, di- and monomethylated lysine 4 of histone H3. This protein plays a role in the transcriptional repression or certain tumor suppressor genes and is upregulated in certain cancer cells. This protein may also play a role in genome stability and DNA repair. Alternate splicing resultsi n multiple transcript variants.

UniProt: Q9UGL1

Pathways: Warburg Effect