Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

MEAF6 antibody (MYST/Esa1-Associated Factor 6) (N-Term) Primary Antibody

MEAF6 Reactivity: Human IHC (p), WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN5648970
$620.00
Plus shipping costs $45.00
100 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    MEAF6
    Binding Specificity
    • 5
    • 3
    • 2
    • 1
    N-Term
    Reactivity
    • 26
    • 19
    • 18
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Human
    Host
    • 26
    Rabbit
    Clonality
    • 26
    Polyclonal
    Conjugate
    • 8
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This MEAF6 antibody is un-conjugated
    Application
    • 16
    • 12
    • 8
    • 3
    • 3
    • 3
    • 1
    • 1
    Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
    Purpose
    Rabbit polyclonal antibody raised against synthetic peptide of human C1orf149.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: A synthetic peptide corresponding to N-terminus of human C1orf149.

    Immunogen Sequence: HNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQM

  • Application Notes
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 μg/mL)
    Western Blot (0.2-1 μg/mL)
    The optimal working dilution should be determined by the end user.
    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    In PBS (2 % sucrose, 0.09 % sodium azide).
    Storage
    4 °C,-20 °C
    Storage Comment
    Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Target
    MEAF6
    Alternative Name
    C1orf149 (MEAF6 Antibody Abstract)
    Synonyms
    fj63g06, wu:fj63g06, zgc:100869, C1orf149, CENP-28, EAF6, NY-SAR-91, C3H1orf149, 2310005N01Rik, 2810036M01Rik, RGD1310440, MYST/Esa1-associated factor 6, MYST/Esa1 associated factor 6, MYST/Esa1-associated factor 6 S homeolog, meaf6, MEAF6, meaf6.S, Meaf6
    Background
    Full Gene Name: chromosome 1 open reading frame 149
    Synonyms: CDABP0189,Eaf6,FLJ11730,NY-SAR-91
    Gene ID
    64769
    NCBI Accession
    NP_073593, NM_022756
    UniProt
    Q9HAF1
You are here:
help Support