Anaphase Promoting Complex Subunit 15 (ANAPC15) antibody

Details for Product No. ABIN5649469
Antigen
Reactivity
Human
12
11
11
2
2
2
2
2
2
1
Host
Rabbit
12
Clonality
Polyclonal
Conjugate
Un-conjugated
1
1
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
7
4
4
1
Options
Purpose Rabbit polyclonal antibody raised against recombinant C11orf51.
Immunogen

immunogen: Recombinant protein corresponding to amino acids of human C11orf51.

Immunogen Sequence: PSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEED

Isotype IgG
Cross-Reactivity Human
Antigen
Alternative Name C11orf51 (ANAPC15 Antibody Abstract)
Background Full Gene Name: chromosome 11 open reading frame 51
Synonyms: DKFZp564M082,HSPC020
Gene ID 25906
UniProt P60006
Application Notes Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Restrictions For Research Use only
Format Liquid
Buffer In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)
Storage 4 °C,-20 °C
Storage Comment Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Anaphase Promoting Complex Subunit 15 (ANAPC15) antibody (ABIN5649469) Immunohistochemical staining of human appendix with C11orf51 polyclonal antibody sho...
Image no. 2 for anti-Anaphase Promoting Complex Subunit 15 (ANAPC15) antibody (ABIN5649469) Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T ly...