Coagulation Factor III (thromboplastin, Tissue Factor) (F3) antibody

Details for Product No. ABIN5649946
Antigen
  • CD142
  • TF
  • TFA
  • f3
  • AA409063
  • Cf-3
  • Cf3
  • tf
  • zgc:112151
  • coagulation factor III, tissue factor
  • coagulation factor IIIa
  • coagulation factor III
  • tissue factor
  • coagulation factor IIIb
  • coagulation factor III (thromboplastin, tissue factor) S homeolog
  • F3
  • f3a
  • tf
  • f3b
  • f3.S
Reactivity
Human
182
56
49
21
20
3
3
2
1
Host
Mouse
150
72
12
9
1
Clonality (Clone)
Monoclonal ()
Conjugate
Un-conjugated
28
26
6
5
4
3
3
3
3
3
3
2
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
163
89
75
64
21
20
20
15
14
13
13
4
4
4
3
2
2
1
1
1
Options
Purpose Mouse monoclonal antibody raised against partial recombinant human F3.
Immunogen

immunogen: Recombinant protein corresponding to human F3.

Immunogen Sequence: VKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGEN

Clone CL3805
Isotype IgG1
Cross-Reactivity Human
Antigen
Alternative Name F3 (F3 Antibody Abstract)
Background Full Gene Name: coagulation factor III (thromboplastin, tissue factor)
Synonyms: CD142,TF,TFA
Gene ID 2152
UniProt P13726
Pathways Positive Regulation of Endopeptidase Activity, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling
Application Notes Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Restrictions For Research Use only
Format Liquid
Buffer In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide).
Storage 4 °C,-20 °C
Storage Comment Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Coagulation Factor III (thromboplastin, Tissue Factor) (F3) antibody (ABIN5649946) Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human pla...
Image no. 2 for anti-Coagulation Factor III (thromboplastin, Tissue Factor) (F3) antibody (ABIN5649946) Western Blot (Cell lysate) analysis of A-431 cell lysate.
Did you look for something else?