Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Zinc Finger Protein 703 (ZNF703) antibody Primary Antibody

ZNF703 Reactivity: Human IHC (p), WB Host: Mouse Monoclonal CL0654 unconjugated
Catalog No. ABIN5650324
$737.33
Plus shipping costs $45.00
100 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    Zinc Finger Protein 703 (ZNF703)
    Reactivity
    • 54
    • 8
    • 8
    • 6
    • 5
    • 5
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    Human
    Host
    • 47
    • 7
    Mouse
    Clonality
    • 54
    Monoclonal
    Conjugate
    • 17
    • 6
    • 5
    • 5
    • 3
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Un-conjugated
    Application
    • 36
    • 31
    • 13
    • 4
    • 3
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
    Purpose
    Mouse monoclonal antibody raised against partial recombinant human ZNF703.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: Recombinant protein corresponding to human ZNF703.

    Immunogen Sequence: PYSKGSGGGDSRKDSGSSSVSSTSSSSSSSPGDKAGFRVPSAACPPFPPHGAPVSASSSSS

    Clone
    CL0654
    Isotype
    IgG1
  • Application Notes
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
    Western Blot (1:500-1:1000)
    The optimal working dilution should be determined by the end user.
    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide).
    Storage
    4 °C,-20 °C
    Storage Comment
    Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Target
    Zinc Finger Protein 703 (ZNF703)
    Alternative Name
    ZNF703 (ZNF703 Antibody Abstract)
    Synonyms
    ZEPPO1, ZNF503L, ZPO1, 1110032O19Rik, AI430822, AL022941, Csmn1, End2, Zeppo1, Znf703, Zpo1, NH11, cb514, fc45d06, fk28e09, nlz, nlz1, noz1, wu:fc45d06, wu:fk28e09, zgc:111927, zinc finger protein 703, ZNF703, Zfp703, znf703
    Background
    Full Gene Name: zinc finger protein 703
    Synonyms: FLJ14299,ZNF503L
    Gene ID
    80139
    UniProt
    Q9H7S9
    Pathways
    Cell-Cell Junction Organization
You are here:
help Support