Protocadherin gamma Subfamily A, 2 (PCDHGA2) (AA 223-331) antibody

Details for Product No. ABIN565988
Antigen
Epitope
AA 223-331
2
1
1
Reactivity
Human
5
Host
Mouse
4
1
Clonality
Polyclonal
Application
ELISA, Western Blotting (WB)
5
4
2
1
1
1
1
Options
Purpose Mouse polyclonal antibody raised against a partial recombinant PCDHGA2.
Immunogen

immunogen: PCDHGA2 (NP_061738, 223 a.a. ~ 331 a.a) partial recombinant protein with GST tag.

Immunogen Sequence: SGTSRICVKVLDANDNAPVFTQPEYRISIPENTLVGTRILTVTATDADEGYYAQVVYFLEKSPGETSEVFELKSTSGELTIIKDLDYEDATFHEIDIEAQDGPGLLTRA

Cross-Reactivity Human
Antigen
Alternative Name PCDHGA2 (PCDHGA2 Antibody Abstract)
Background Full Gene Name: protocadherin gamma subfamily A, 2
Synonyms: PCDH-GAMMA-A2
Gene ID 56113
NCBI Accession NP_061738, NM_018915
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Format Liquid
Buffer 50 % glycerol
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Protocadherin gamma Subfamily A, 2 (PCDHGA2) (AA 223-331) antibody (ABIN565988) Western Blot detection against Immunogen (38.1 KDa) .