Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

MOSPD3 antibody (Motile Sperm Domain Containing 3) (AA 43-141) Primary Antibody

MOSPD3 Reactivity: Human ELISA, WB Host: Mouse Polyclonal unconjugated
Catalog No. ABIN566268
$465.71
Plus shipping costs $45.00
50 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    MOSPD3
    Binding Specificity
    • 9
    • 8
    • 7
    • 7
    • 3
    • 1
    • 1
    • 1
    AA 43-141
    Reactivity
    • 24
    • 4
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Human
    Host
    • 21
    • 3
    Mouse
    Clonality
    • 22
    • 2
    Polyclonal
    Conjugate
    • 12
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    This MOSPD3 antibody is un-conjugated
    Application
    • 22
    • 18
    • 4
    • 1
    ELISA, Western Blotting (WB)
    Purpose
    Mouse polyclonal antibody raised against a partial recombinant MOSPD3.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: MOSPD3 (NP_076438, 43 a.a. ~ 141 a.a) partial recombinant protein with GST tag.

    Immunogen Sequence: FRADQRSGPRQLLTLYNPTGTALRFRVLCTAPAKYTVFDAEGYVKPQSCIDIVIRHVAPIPSHYDVQDRFRIELSEEGAEGRVVGRKDITSILRAPAYP

  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    50 % glycerol
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    MOSPD3
    Alternative Name
    MOSPD3 (MOSPD3 Antibody Abstract)
    Synonyms
    CDS3, NET30, 1190005J19Rik, 5133401H10Rik, Gtig2, R124, cds3, MGC89012, MOSPD3, motile sperm domain containing 3, motile sperm domain containing 3 L homeolog, MOSPD3, Mospd3, mospd3, mospd3.L
    Background
    Full Gene Name: motile sperm domain containing 3
    Synonyms: CDS3
    Gene ID
    64598
    NCBI Accession
    NP_076438, NM_023948
You are here:
help Support