PIAS3 antibody

Catalog No. ABIN5692909

Product Details anti-PIAS3 Antibody

Target: PIAS3 (Protein Inhibitor of Activated STAT, 3 (PIAS3))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PIAS3 antibody is un-conjugated

Application: Western Blotting (WB)

Brand: Picoband™

Sequence: QRFEEAHFTF ALTPQQVQQI LTSREVLPGA KCDYTIQVQL RF

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for PIAS3 detection. Tested with WB in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human PIAS3 (QRFEEAHFTFALTPQQVQQILTSREVLPGAKCDYTIQVQLRF).

Application Details

Application Notes:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Target Details for PIAS3

Target: PIAS3 (Protein Inhibitor of Activated STAT, 3 (PIAS3))

Alternative Name: PIAS3 (PIAS3 Products)

Synonyms: PIAS3 antibody, Pias3l antibody, ZMIZ5 antibody, protein inhibitor of activated STAT 3 antibody, protein inhibitor of activated STAT, 3 antibody, protein inhibitor of activated STAT 3 L homeolog antibody, PIAS3 antibody, pias3 antibody, Pias3 antibody, pias3.L antibody

Background:

Synonyms: E3 SUMO-protein ligase PIAS3, Protein inhibitor of activated STAT protein 3, PIAS3

Tissue Specificity: Widely expressed.

Background: E3 SUMO-protein ligase PIAS3 is an enzyme that in humans is encoded by the PIAS3 gene. This gene encodes a member of the PIAS [protein inhibitor of activated STAT (signal transducer and activator of transcription)] family of transcriptional modulators. The protein functions as a SUMO (small ubiquitin-like modifier)-E3 ligase which catalyzes the covalent attachment of a SUMO protein to specific target substrates. It directly binds to several transcription factors and either blocks or enhances their activity. Alternatively spliced transcript variants of this gene have been identified, but the full-length nature of some of these variants has not been determined.

UniProt: Q9Y6X2

Pathways: JAK-STAT Signaling