SOD3 antibody

Catalog No. ABIN5692939

Product Details anti-SOD3 Antibody

Target: SOD3 (Superoxide Dismutase 3, Extracellular (SOD3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SOD3 antibody is un-conjugated

Application: Immunohistochemistry (IHC)

Brand: Picoband™

Sequence: WTGEDSAEPN SDSAEWIRDM YAKVTEIWQE VMQRRDDD

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for SOD3 detection. Tested with IHC-P in Human

Immunogen: A synthetic peptide corresponding to a sequence of human SOD3 (WTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDD).

Application Details

Application Notes:

Recommended Detection Systems: HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

References for anti-SOD3 antibody (ABIN5692939)

Li, Xiao, Li, Li, Zeng, Liu, Liang, Li, Chu, Yang: "Hydrogen sulfide reduced renal tissue fibrosis by regulating autophagy in diabetic rats." in: Molecular medicine reports, Vol. 16, Issue 2, pp. 1715-1722, (2018) (PubMed).

Target Details for SOD3

Target: SOD3 (Superoxide Dismutase 3, Extracellular (SOD3))

Alternative Name: SOD3 (SOD3 Products)

Synonyms: EC-SOD antibody, ECSOD antibody, SOD3 antibody, AI314465 antibody, LOC780439 antibody, fb05f10 antibody, si:dkey-117m1.6 antibody, sod3 antibody, wu:fb05f10 antibody, ECSODPT antibody, CuZnSOD antibody, SODA.4 antibody, superoxide dismutase 3 antibody, superoxide dismutase 3, extracellular antibody, superoxide dismutase 3, extracellular b antibody, superoxide dismutase 1 antibody, superoxide dismutase precursor ,putative antibody, SOD3 antibody, Sod3 antibody, sod3b antibody, sod3 antibody, Sod1 antibody, Smp_095980 antibody

Background:

Synonyms: Extracellular superoxide dismutase [Cu-Zn], EC-SOD, 1.15.1.1, SOD3

Tissue Specificity: Expressed in blood vessels, heart, lung, kidney and placenta. Major SOD isoenzyme in extracellular fluids such as plasma, lymph and synovial fluid.

Background: SOD3 (SUPEROXIDE DISMUTASE 3), also called SUPEROXIDE DISMUTASE, EXTRACELLULAR, EC-SOD, and Cu-Zn, is an enzyme that in humans is encoded by the SOD3 gene. This gene encodes a member of the superoxide dismutase (SOD) protein family. SODs are antioxidant enzymes that catalyze the dismutation of two superoxide radicals into hydrogen peroxide and oxygen. Hendrickson et al. (1990) mapped the SOD3 gene to 4pter-q21 by a study of somatic cell hybrids. Stern et al. (2003) narrowed the assignment to 4p15.3-p15.1 by somatic cell and radiation hybrid analysis, linkage mapping, and FISH. The product of this gene is thought to protect the brain, lungs, and other tissues from oxidative stress. The protein is secreted into the extracellular space and forms a glycosylated homotetramer that is anchored to the extracellular matrix (ECM) and cell surfaces through an interaction with heparan sulfate proteoglycan and collagen. A fraction of the protein is cleaved near the C-terminus before secretion to generate circulating tetramers that do not interact with the ECM.

UniProt: P08294