SLC31A1 antibody

Catalog No. ABIN5693022

Product Details anti-SLC31A1 Antibody

Target: SLC31A1 (Solute Carrier Family 31 (Copper Transporters), Member 1 (SLC31A1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC31A1 antibody is un-conjugated

Application: Western Blotting (WB)

Brand: Picoband™

Sequence: NGTILMETHK TVGQQMLSFP HLLQTVLHII Q

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for SLC31A1/CTR1 detection. Tested with WB in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human SLC31A1/CTR1 (NGTILMETHKTVGQQMLSFPHLLQTVLHIIQ).

Application Details

Application Notes:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Target Details for SLC31A1

Target: SLC31A1 (Solute Carrier Family 31 (Copper Transporters), Member 1 (SLC31A1))

Alternative Name: SLC31A1 (SLC31A1 Products)

Synonyms: SLC31A1 antibody, Xctr1 antibody, copt1 antibody, ctr1 antibody, hctr1 antibody, K19M22.24 antibody, copper transporter 1 antibody, Slc31a1 antibody, COPT1 antibody, CTR1 antibody, Ctr1 antibody, LRRGT00200 antibody, ctr-1 antibody, zgc:76839 antibody, 4930445G01Rik antibody, AI787263 antibody, AU016967 antibody, solute carrier family 31 member 1 antibody, copper transporter 1 antibody, solute carrier family 31 (copper transporter), member 1 antibody, solute carrier family 31, member 1 antibody, SLC31A1 antibody, LOC100281410 antibody, LOC100286321 antibody, slc31a1 antibody, COPT1 antibody, Slc31a1 antibody

Background:

Synonyms: High affinity copper uptake protein 1, Copper transporter 1, hCTR1, Solute carrier family 31 member 1, SLC31A1, COPT1, CTR1

Background: High affinity copper uptake protein 1 (Ctr1) is a protein that in humans is encoded by the SLC31A1 gene. This gene is maped to 9q32. The protein encoded by this gene is a high-affinity copper transporter found in the cell membrane. The encoded protein functions as a homotrimer to effect the uptake of dietary copper.

UniProt: O15431