ABCB1 antibody

Catalog No. ABIN5693064

Product Details anti-ABCB1 Antibody

Target: ABCB1 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABCB1 antibody is un-conjugated

Application: Western Blotting (WB)

Sequence: QAQDRKLSTK EALDESIPPV SFWRIMKLNL TEWPY

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for P Glycoprotein detection. Tested with WB in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human P Glycoprotein (QAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPY).

Application Details

Application Notes:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

References for anti-ABCB1 antibody (ABIN5693064)

Chen, Liu, Chen, Xu, Xiao, Hu, Mao, Wang: "A 20(S)-protopanoxadiol derivative overcomes multi-drug resistance by antagonizing ATP-binding cassette subfamily B member 1 transporter function." in: Oncotarget, Vol. 7, Issue 8, pp. 9388-403, (2017) (PubMed).

Target Details for ABCB1

Target: ABCB1 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1))

Alternative Name: ABCB1 (ABCB1 Products)

Synonyms: ABC20 antibody, CD243 antibody, CLCS antibody, GP170 antibody, MDR1 antibody, P-GP antibody, PGY1 antibody, Abcb1 antibody, Mdr1a antibody, p-gp antibody, xemdr antibody, Mdr1 antibody, Mdr1b antibody, Pgy-1 antibody, Pgy1 antibody, mdr antibody, ABCB1 antibody, PGP1 antibody, ATP binding cassette subfamily B member 1 antibody, ATP binding cassette subfamily B member 1A antibody, ATP binding cassette subfamily B member 1 L homeolog antibody, ATP-binding cassette, sub-family B (MDR/TAP), member 1B antibody, ABCB1 antibody, Abcb1a antibody, abcb1.L antibody, Abcb1b antibody, Abcb1 antibody

Background:

Synonyms: Multidrug resistance protein 1, ATP-binding cassette sub-family B member 1, P-glycoprotein 1, CD243, ABCB1, MDR1, PGY1

Tissue Specificity: Expressed in liver, kidney, small intestine and brain.

Background: P-GP, also called ABCB1 or PGY1, is a glycoprotein that in humans is encoded by the ABCB1 gene. It is mapped to 7q21.12. P-GP is a well-characterized ABC-transporter (which transports a wide variety of substrates across extra- and intracellular membranes) of the MDR/TAP subfamily. It is an important protein of the cell membrane that pumps many foreign substances out of cells. More formally, it is an ATP-dependent drug efflux pump with broad substrate specificity. P-GP is an ATP-dependent drug efflux pump forxenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier.

UniProt: P08183