BAX antibody (N-Term) (DyLight 488)
-
- Target See all BAX Antibodies
- BAX (BCL2-Associated X Protein (BAX))
-
Binding Specificity
- AA 17-48, N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BAX antibody is conjugated to DyLight 488
-
Application
- Flow Cytometry (FACS)
- Sequence
- EQIMKTGALL LQGFIQDRAG RMGGEAPELA LD
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
- Rabbit IgG Polyclonal Anti-Human Bax Antibody DyLight® 488 Conjugated, Flow Validated.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human Bax (17-48aa EQIMKTGALLLQGFIQDRAGRMGGEAPELALD), different from the related mouse and rat sequences by five amino acids.
- Top Product
- Discover our top product BAX Primary Antibody
-
-
- Application Notes
-
Application Details: Flow Cytometry, 1-3 μg/1x106 cells
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C
- Storage Comment
- At 2-8°C for one year. Protect from light. Do not freeze.
-
-
A novel polysaccharide from Sargassum integerrimum induces apoptosis in A549 cells and prevents angiogensis in vitro and in vivo." in: Scientific reports, Vol. 6, pp. 26722, (2018) (PubMed).
: "BMP‑7 suppresses excessive scar formation by activating the BMP‑7/Smad1/5/8 signaling pathway." in: Molecular medicine reports, Vol. 16, Issue 2, pp. 1957-1963, (2018) (PubMed).
: "Emodin alleviates severe acute pancreatitis-associated acute lung injury by decreasing pre-B-cell colony-enhancing factor expression and promoting polymorphonuclear neutrophil apoptosis." in: Molecular medicine reports, Vol. 16, Issue 4, pp. 5121-5128, (2018) (PubMed).
: "Ailanthone induces G2/M cell cycle arrest and apoptosis of SGC‑7901 human gastric cancer cells." in: Molecular medicine reports, Vol. 16, Issue 5, pp. 6821-6827, (2018) (PubMed).
: "Fibroblast growth factor 21 protects rat cardiomyocytes from endoplasmic reticulum stress by promoting the fibroblast growth factor receptor 1-extracellular signal‑regulated kinase 1/2 signaling ..." in: International journal of molecular medicine, Vol. 40, Issue 5, pp. 1477-1485, (2018) (PubMed).
: "Magnesium isoglycyrrhizinate ameliorates doxorubicin-induced acute cardiac and hepatic toxicity via anti-oxidant and anti-apoptotic mechanisms in mice." in: Experimental and therapeutic medicine, Vol. 15, Issue 1, pp. 1005-1012, (2018) (PubMed).
: "Effects of 5-hydroxy-4'-nitro-7-propionyloxy-genistein on inhibiting proliferation and invasion via activating reactive oxygen species in human ovarian cancer A2780/DDP cells." in: Oncology letters, Vol. 15, Issue 4, pp. 5227-5235, (2018) (PubMed).
: "Hepatitis E Virus Induces Hepatocyte Apoptosis via Mitochondrial Pathway in Mongolian Gerbils." in: Frontiers in microbiology, Vol. 9, pp. 460, (2018) (PubMed).
: "Ginsenoside Rb1 inhibit apoptosis in rat model of Alzheimer's disease induced by Aβ1-40." in: American journal of translational research, Vol. 10, Issue 3, pp. 796-805, (2018) (PubMed).
: "Ginkgolic acids induce HepG2 cell death via a combination of apoptosis, autophagy and the mitochondrial pathway." in: Oncology letters, Vol. 15, Issue 5, pp. 6400-6408, (2018) (PubMed).
: "Catalpol inhibits apoptosis in hydrogen peroxide-induced cardiac myocytes through a mitochondrial-dependent caspase pathway." in: Bioscience reports, Vol. 36, Issue 3, (2017) (PubMed).
: "Knockdown of High Mobility Group-Box 3 (HMGB3) Expression Inhibits Proliferation, Reduces Migration, and Affects Chemosensitivity in Gastric Cancer Cells." in: Medical science monitor : international medical journal of experimental and clinical research, Vol. 22, pp. 3951-3960, (2017) (PubMed).
: "Thymic cytoarchitecture changes in mice exposed to vanadium." in: Journal of immunotoxicology, Vol. 14, Issue 1, pp. 9-14, (2017) (PubMed).
: "Effects of Bushen Tianjing Recipe in a rat model of tripterygium glycoside-induced premature ovarian failure." in: Chinese medicine, Vol. 12, pp. 10, (2017) (PubMed).
: "Nogo receptor knockdown and ciliary neurotrophic factor attenuate diabetic retinopathy in streptozotocin-induced diabetic rats." in: Molecular medicine reports, Vol. 16, Issue 2, pp. 2030-2036, (2017) (PubMed).
: "RKTG overexpression inhibits proliferation and induces apoptosis of human leukemia cells via suppression of the ERK and PI3K/AKT signaling pathways." in: Oncology letters, Vol. 14, Issue 1, pp. 965-970, (2017) (PubMed).
: "Siva 1 inhibits proliferation, migration and invasion by phosphorylating Stathmin in ovarian cancer cells." in: Oncology letters, Vol. 14, Issue 2, pp. 1512-1518, (2017) (PubMed).
: "Blockade of sonic hedgehog signaling decreases viability and induces apoptosis in retinoblastoma cells: The key role of the PI3K/Akt pathway." in: Oncology letters, Vol. 14, Issue 4, pp. 4099-4105, (2017) (PubMed).
: "Triptolide inhibits proliferation, differentiation and induces apoptosis of osteoblastic MC3T3‑E1 cells." in: Molecular medicine reports, Vol. 16, Issue 5, pp. 7391-7397, (2017) (PubMed).
: "Downregulation of BRAF-activated non-coding RNA suppresses the proliferation, migration and invasion, and induces apoptosis of hepatocellular carcinoma cells." in: Oncology letters, Vol. 14, Issue 4, pp. 4751-4757, (2017) (PubMed).
: "
-
A novel polysaccharide from Sargassum integerrimum induces apoptosis in A549 cells and prevents angiogensis in vitro and in vivo." in: Scientific reports, Vol. 6, pp. 26722, (2018) (PubMed).
-
- Target
- BAX (BCL2-Associated X Protein (BAX))
- Alternative Name
- BAX (BAX Products)
- Synonyms
- BAX-ALPHA antibody, bax-A antibody, xBax antibody, xlbax antibody, BAX antibody, bax antibody, fj16e01 antibody, wu:fc50b10 antibody, wu:fj16e01 antibody, BCL2L4 antibody, zgc:112983 antibody, BCL2 associated X, apoptosis regulator antibody, BCL2-associated X protein L homeolog antibody, BCL2-associated X protein antibody, bcl2-associated X protein, a antibody, bcl2-associated X protein, b antibody, BAX antibody, bax.L antibody, bax antibody, baxa antibody, Bax antibody, baxb antibody
- Background
-
Synonyms: Apoptosis regulator BAX, Bcl-2-like protein 4, Bcl2-L-4, BAX, BCL2L4
Tissue Specificity: Expressed in a wide variety of tissues. Isoform Psi is found in glial tumors. Isoform Alpha is expressed in spleen, breast, ovary, testis, colon and brain, and at low levels in skin and lung. Isoform Sigma is expressed in spleen, breast, ovary, testis, lung, colon, brain and at low levels in skin. Isoform Alpha and isoform Sigma are expressed in pro- myelocytic leukemia, histiocytic lymphoma, Burkitt's lymphoma, T- cell lymphoma, lymphoblastic leukemia, breast adenocarcinoma, ovary adenocarcinoma, prostate carcinoma, prostate adenocarcinoma, lung carcinoma, epidermoid carcinoma, small cell lung carcinoma and colon adenocarcinoma cell lines.
Background: Apoptosis regulator BAX, also known as bcl-2-like protein 4, is a protein that in humans is encoded by the BAX gene. The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. Additionally, this protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.
- UniProt
- Q07812
- Pathways
- p53 Signaling, PI3K-Akt Signaling, Apoptosis, Caspase Cascade in Apoptosis, Positive Regulation of Endopeptidase Activity, Unfolded Protein Response
-